Lineage for d1b33h_ (1b33 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302309Protein Allophycocyanin alpha subunit [88953] (3 species)
  7. 2302310Species Mastigocladus laminosus [TaxId:83541] [88955] (1 PDB entry)
  8. 2302314Domain d1b33h_: 1b33 H: [15655]
    Other proteins in same PDB: d1b33b_, d1b33d_, d1b33f_, d1b33i_, d1b33k_, d1b33m_, d1b33n_, d1b33o_
    complexed with bla, bo4, cyc

Details for d1b33h_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
PDB Compounds: (H:) allophycocyanin, alpha chain

SCOPe Domain Sequences for d1b33h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33h_ a.1.1.3 (H:) Allophycocyanin alpha subunit {Mastigocladus laminosus [TaxId: 83541]}
sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
pidavaagvsamknvassilsaedaaeagayfdyvagala

SCOPe Domain Coordinates for d1b33h_:

Click to download the PDB-style file with coordinates for d1b33h_.
(The format of our PDB-style files is described here.)

Timeline for d1b33h_: