| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein Allophycocyanin alpha subunit [88953] (3 species) |
| Species Mastigocladus laminosus [TaxId:83541] [88955] (1 PDB entry) |
| Domain d1b33h_: 1b33 H: [15655] Other proteins in same PDB: d1b33b_, d1b33d_, d1b33f_, d1b33i_, d1b33k_, d1b33m_, d1b33n_, d1b33o_ complexed with bla, bo4, cyc |
PDB Entry: 1b33 (more details), 2.3 Å
SCOPe Domain Sequences for d1b33h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b33h_ a.1.1.3 (H:) Allophycocyanin alpha subunit {Mastigocladus laminosus [TaxId: 83541]}
sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
pidavaagvsamknvassilsaedaaeagayfdyvagala
Timeline for d1b33h_: