Lineage for d3cf5i1 (3cf5 I:4-144)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824197Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 824198Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 824199Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 824200Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 824242Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
    Uniprot Q9RSK9 4-144
  8. 824246Domain d3cf5i1: 3cf5 I:4-144 [156549]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR I:4-144
    complexed with mg, txx

Details for d3cf5i1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (I:) 50S ribosomal protein L15

SCOP Domain Sequences for d3cf5i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5i1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOP Domain Coordinates for d3cf5i1:

Click to download the PDB-style file with coordinates for d3cf5i1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5i1: