Lineage for d3cf5f1 (3cf5 F:72-144)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308817Species Deinococcus radiodurans [TaxId:1299] [158348] (4 PDB entries)
    Uniprot Q9RSS7 72-144
  8. 2308818Domain d3cf5f1: 3cf5 F:72-144 [156545]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJQ F:72-144
    protein/RNA complex; complexed with mg

Details for d3cf5f1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cf5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5f1 a.4.7.1 (F:72-144) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsveaaantvagta
rsmgvtveggpna

SCOPe Domain Coordinates for d3cf5f1:

Click to download the PDB-style file with coordinates for d3cf5f1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5f1: