SCOPe 2.07: Domain d3cf5e2: 3cf5 E:5-82

Lineage for d3cf5e2 (3cf5 E:5-82)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
   Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172

8. Domain d3cf5e2: 3cf5 E:5-82 [156544]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR E:5-82
   protein/RNA complex; complexed with mg

Details for d3cf5e2

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3cf5e2:

Sequence; same for both SEQRES and ATOM records:

>d3cf5e2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdg

Timeline for d3cf5e2:

• d3cf5e2 first appeared in SCOP 1.75
  
• d3cf5e2 appears in SCOPe 2.06
  
• d3cf5e2 appears in the current release, SCOPe 2.08