Lineage for d3cf5d1 (3cf5 D:3-179)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565168Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2565169Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2565170Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2565171Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2565175Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
    Uniprot Q9RXJ0 3-179
  8. 2565178Domain d3cf5d1: 3cf5 D:3-179 [156542]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR D:3-179
    protein/RNA complex; complexed with mg

Details for d3cf5d1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d3cf5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5d1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOPe Domain Coordinates for d3cf5d1:

Click to download the PDB-style file with coordinates for d3cf5d1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5d1: