Lineage for d3cf5c1 (3cf5 C:2-198)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355944Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1355945Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 1355946Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1355947Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1355948Species Deinococcus radiodurans [TaxId:1299] [159478] (6 PDB entries)
    Uniprot Q9RXK1 2-198
  8. 1355950Domain d3cf5c1: 3cf5 C:2-198 [156541]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR C:2-198
    protein/RNA complex; complexed with mg

Details for d3cf5c1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (C:) 50S ribosomal protein L4

SCOPe Domain Sequences for d3cf5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5c1 c.22.1.1 (C:2-198) Ribosomal protein L4 {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOPe Domain Coordinates for d3cf5c1:

Click to download the PDB-style file with coordinates for d3cf5c1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5c1: