SCOPe 2.07: Domain d3cf5a1: 3cf5 A:128-272

Lineage for d3cf5a1 (3cf5 A:128-272)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159028] (5 PDB entries)
   Uniprot Q9RXJ9 128-272

8. Domain d3cf5a1: 3cf5 A:128-272 [156538]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR A:128-272
   protein/RNA complex; complexed with mg

Details for d3cf5a1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d3cf5a1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5a1 b.34.5.3 (A:128-272) C-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
gnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelrrvhs
ecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgagrvpv
tpwgkptkglktrrkrktsdrfivt

Timeline for d3cf5a1:

• d3cf5a1 first appeared in SCOP 1.75
  
• d3cf5a1 appears in SCOPe 2.06
  
• d3cf5a1 appears in the current release, SCOPe 2.08