SCOPe 2.05: Domain d3cf531: 3cf5 3:2-64

Lineage for d3cf531 (3cf5 3:2-64)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)
   automatically mapped to Pfam PF01632

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
   Uniprot Q9RSW6 2-64

8. Domain d3cf531: 3cf5 3:2-64 [156536]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR 3:2-64
   protein/RNA complex; complexed with mg

Details for d3cf531

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d3cf531:

Sequence; same for both SEQRES and ATOM records:

>d3cf531 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

Timeline for d3cf531:

• d3cf531 first appeared in SCOP 1.75
  
• d3cf531 appears in SCOPe 2.04
  
• d3cf531 appears in SCOPe 2.06
  
• d3cf531 appears in the current release, SCOPe 2.08