SCOP 1.75: Domain d3cepb1: 3cep B:2-394

Lineage for d3cepb1 (3cep B:2-394)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries)

8. Domain d3cepb1: 3cep B:2-394 [156533]
   Other proteins in same PDB: d3cepa1
   automatically matched to d1k3ub_
   complexed with cs, g3h, idm, plp, sri

Details for d3cepb1

PDB Entry: 3cep, 2.1 Å

PDB Description: Structure of a tryptophan synthase quinonoid intermediate

PDB Compounds: (B:) tryptophan synthase beta chain

SCOP Domain Sequences for d3cepb1:

Sequence; same for both SEQRES and ATOM records:

>d3cepb1 c.79.1.1 (B:2-394) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

Timeline for d3cepb1:

• d3cepb1 is new in SCOP 1.75
  
• d3cepb1 is called d3cepb_ in SCOPe 2.01
  
• d3cepb1 appears in the current release, SCOPe 2.08, called d3cepb_