Lineage for d3cepa_ (3cep A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) Protein Trp synthase alpha-subunit [51388] (9 species) Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries) 
Domain d3cepa_: 3cep A: [156532]
Other proteins in same PDB: d3cepb_
automated match to d1k3ua_
complexed with cs, g3p, plp
Details for d3cepa_
PDB Entry: 3cep (more details), 2.1 Å
PDB Description: Structure of a tryptophan synthase quinonoid intermediate
PDB Compounds: (A:) tryptophan synthase alpha chainSCOPe Domain Sequences for d3cepa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cepa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasr
SCOPe Domain Coordinates for d3cepa_:
Click to download the PDB-style file with coordinates for d3cepa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cepa_:
- d3cepa_ first appeared in SCOP 1.75, called d3cepa1
- d3cepa_ appears in SCOPe 2.07
View in 3D
