Lineage for d1b33e_ (1b33 E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 737Family a.1.1.3: Phycocyanins [46532] (5 proteins)
  6. 738Protein Allophycocyanin [46537] (2 species)
  7. 739Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [46539] (1 PDB entry)
  8. 744Domain d1b33e_: 1b33 E: [15653]
    Other proteins in same PDB: d1b33n_, d1b33o_

Details for d1b33e_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8

SCOP Domain Sequences for d1b33e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33e_ a.1.1.3 (E:) Allophycocyanin {Cyanobacterium (Mastigocladus laminosus)}
sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
pidavaagvsamknvassilsaedaaeagayfdyvagala

SCOP Domain Coordinates for d1b33e_:

Click to download the PDB-style file with coordinates for d1b33e_.
(The format of our PDB-style files is described here.)

Timeline for d1b33e_: