SCOP 1.57: Domain d1b33d_: 1b33 D:

Lineage for d1b33d_ (1b33 D:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)

6. Protein Allophycocyanin [46537] (2 species)

7. Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [46539] (1 PDB entry)

8. Domain d1b33d_: 1b33 D: [15652]
   Other proteins in same PDB: d1b33n_, d1b33o_

Details for d1b33d_

PDB Entry: 1b33, 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8

SCOP Domain Sequences for d1b33d_:

Sequence; same for both SEQRES and ATOM records:

>d1b33d_ a.1.1.3 (D:) Allophycocyanin {Cyanobacterium (Mastigocladus laminosus)}
mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls

Timeline for d1b33d_:

• d1b33d_ first appeared (with stable ids) in SCOP 1.55
  
• d1b33d_ appears in SCOP 1.59
  
• d1b33d_ appears in the current release, SCOPe 2.08