Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
Domain d3cdgc2: 3cdg C:2-181 [156516] Other proteins in same PDB: d3cdga1, d3cdgb1, d3cdgc1, d3cdgd1, d3cdge1, d3cdgj1 automatically matched to d1mhea2 |
PDB Entry: 3cdg (more details), 3.4 Å
SCOP Domain Sequences for d3cdgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cdgc2 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d3cdgc2: