Lineage for d3cdga2 (3cdg A:2-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198244Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 1198258Domain d3cdga2: 3cdg A:2-181 [156513]
    Other proteins in same PDB: d3cdga1, d3cdgb1, d3cdgc1, d3cdgd1, d3cdge1, d3cdgj1
    automatically matched to d1mhea2

Details for d3cdga2

PDB Entry: 3cdg (more details), 3.4 Å

PDB Description: Human CD94/NKG2A in complex with HLA-E
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3cdga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdga2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d3cdga2:

Click to download the PDB-style file with coordinates for d3cdga2.
(The format of our PDB-style files is described here.)

Timeline for d3cdga2: