SCOPe 2.05: Domain d3cddf1: 3cdd F:181-345

Lineage for d3cddf1 (3cdd F:181-345)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (3 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate protein gpP [159179] (3 species)
   43 kda tail protein; Pfam PF06893

7. Species Shewanella oneidensis [TaxId:70863] [159182] (1 PDB entry)
   Uniprot Q8EDP4 181-348! Uniprot Q8EDP4 2-180
   Prophage MuSo2

8. Domain d3cddf1: 3cdd F:181-345 [156510]
   automated match to d3cdda1

Details for d3cddf1

PDB Entry: 3cdd, 2.1 Å

PDB Description: Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis

PDB Compounds: (F:) Prophage MuSo2, 43 kDa tail protein

SCOPe Domain Sequences for d3cddf1:

Sequence, based on SEQRES records:

>d3cddf1 b.106.1.1 (F:181-345) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
asktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikadvt
dseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwnin
tlvpvideimgldeemliasilfseddagrlavisvvrpdamdip

Sequence, based on observed residues (ATOM records):

>d3cddf1 b.106.1.1 (F:181-345) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
asktkagvslilgdnvkaargrfswrqrfskftikaagikadvtdseigryrpliivnee
vttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeem
liasilfseddagrlavisvvrpdamdip

Timeline for d3cddf1:

• d3cddf1 first appeared in SCOP 1.75
  
• d3cddf1 appears in SCOPe 2.04
  
• d3cddf1 appears in SCOPe 2.06
  
• d3cddf1 appears in the current release, SCOPe 2.08