Lineage for d3cddc2 (3cdd C:3-180)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812077Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 812078Superfamily b.106.1: Phage tail proteins [69279] (3 families) (S)
  5. 812079Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 812080Protein Baseplate protein gpP [159179] (3 species)
    43 kda tail protein; Pfam PF06893
  7. 812089Species Shewanella oneidensis [TaxId:70863] [159182] (1 PDB entry)
    Uniprot Q8EDP4 181-348! Uniprot Q8EDP4 2-180
    Prophage MuSo2
  8. 812095Domain d3cddc2: 3cdd C:3-180 [156505]
    automatically matched to 3CDD A:2-180

Details for d3cddc2

PDB Entry: 3cdd (more details), 2.1 Å

PDB Description: Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis
PDB Compounds: (C:) Prophage MuSo2, 43 kDa tail protein

SCOP Domain Sequences for d3cddc2:

Sequence, based on SEQRES records: (download)

>d3cddc2 b.106.1.1 (C:3-180) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
eeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqact
vdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiad
ivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitr

Sequence, based on observed residues (ATOM records): (download)

>d3cddc2 b.106.1.1 (C:3-180) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
eeivlkaggkiyqgwtkigitrsleamsgafdlemtykfqykafiepikqgqactvdigg
ervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadivckp
fgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitr

SCOP Domain Coordinates for d3cddc2:

Click to download the PDB-style file with coordinates for d3cddc2.
(The format of our PDB-style files is described here.)

Timeline for d3cddc2: