Class b: All beta proteins [48724] (174 folds) |
Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
Superfamily b.106.1: Phage tail proteins [69279] (3 families) |
Family b.106.1.1: Baseplate protein-like [69280] (3 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
Protein Baseplate protein gpP [159179] (3 species) 43 kda tail protein; Pfam PF06893 |
Species Shewanella oneidensis [TaxId:70863] [159182] (1 PDB entry) Uniprot Q8EDP4 181-348! Uniprot Q8EDP4 2-180 Prophage MuSo2 |
Domain d3cddc2: 3cdd C:3-180 [156505] automatically matched to 3CDD A:2-180 |
PDB Entry: 3cdd (more details), 2.1 Å
SCOP Domain Sequences for d3cddc2:
Sequence, based on SEQRES records: (download)
>d3cddc2 b.106.1.1 (C:3-180) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]} eeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqact vdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiad ivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitr
>d3cddc2 b.106.1.1 (C:3-180) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]} eeivlkaggkiyqgwtkigitrsleamsgafdlemtykfqykafiepikqgqactvdigg ervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadivckp fgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitr
Timeline for d3cddc2: