SCOPe 2.08: Domain d3cdda2: 3cdd A:2-180

Lineage for d3cdda2 (3cdd A:2-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (4 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (4 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate protein gpP, N-terminal domain [418926] (3 species)
   43 kda tail protein; Pfam PF06893

7. Species Shewanella oneidensis [TaxId:70863] [419358] (1 PDB entry)
   Uniprot Q8EDP4
   Prophage MuSo2

8. Domain d3cdda2: 3cdd A:2-180 [156501]
   Other proteins in same PDB: d3cdda1, d3cddb1, d3cddc1, d3cddd1, d3cdde1, d3cdde3, d3cddf1
   has additional insertions and/or extensions that are not grouped together

Details for d3cdda2

PDB Entry: 3cdd, 2.1 Å

PDB Description: Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis

PDB Compounds: (A:) Prophage MuSo2, 43 kDa tail protein

SCOPe Domain Sequences for d3cdda2:

Sequence; same for both SEQRES and ATOM records:

>d3cdda2 b.106.1.1 (A:2-180) Baseplate protein gpP, N-terminal domain {Shewanella oneidensis [TaxId: 70863]}
seeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqac
tvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqia
divckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitr

Timeline for d3cdda2:

• d3cdda2 first appeared in SCOP 1.75
  
• d3cdda2 appears in SCOPe 2.07