Lineage for d3cdda1 (3cdd A:181-348)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811730Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 1811731Superfamily b.106.1: Phage tail proteins [69279] (3 families) (S)
  5. 1811732Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 1811733Protein Baseplate protein gpP [159179] (3 species)
    43 kda tail protein; Pfam PF06893
  7. 1811742Species Shewanella oneidensis [TaxId:70863] [159182] (1 PDB entry)
    Uniprot Q8EDP4 181-348! Uniprot Q8EDP4 2-180
    Prophage MuSo2
  8. 1811743Domain d3cdda1: 3cdd A:181-348 [156500]

Details for d3cdda1

PDB Entry: 3cdd (more details), 2.1 Å

PDB Description: Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis
PDB Compounds: (A:) Prophage MuSo2, 43 kDa tail protein

SCOPe Domain Sequences for d3cdda1:

Sequence, based on SEQRES records: (download)

>d3cdda1 b.106.1.1 (A:181-348) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
asktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikadvt
dseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwnin
tlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqi

Sequence, based on observed residues (ATOM records): (download)

>d3cdda1 b.106.1.1 (A:181-348) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]}
asktkagvslilgdnvkaargrfswrqrfskftikaakadvtdseigryrpliivneevt
aegaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeemlia
silfseddagrlavisvvrpdamdipaqi

SCOPe Domain Coordinates for d3cdda1:

Click to download the PDB-style file with coordinates for d3cdda1.
(The format of our PDB-style files is described here.)

Timeline for d3cdda1: