SCOPe 2.02: Domain d3cd6y1: 3cd6 Y:95-236

Lineage for d3cd6y1 (3cd6 Y:95-236)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d3cd6y1: 3cd6 Y:95-236 [156498]
   Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6z1
   automatically matched to d1jj2x_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd6y1

PDB Entry: 3cd6, 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3cd6y1:

Sequence; same for both SEQRES and ATOM records:

>d3cd6y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d3cd6y1:

• d3cd6y1 first appeared in SCOP 1.75
  
• d3cd6y1 appears in SCOPe 2.01
  
• d3cd6y1 appears in SCOPe 2.03
  
• d3cd6y1 appears in the current release, SCOPe 2.08