Lineage for d3cd6y1 (3cd6 Y:95-236)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823885Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 823930Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 823931Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 823932Protein Ribosomal protein L32e [52044] (1 species)
  7. 823933Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 823964Domain d3cd6y1: 3cd6 Y:95-236 [156498]
    Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6z1
    automatically matched to d1jj2x_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6y1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOP Domain Sequences for d3cd6y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d3cd6y1:

Click to download the PDB-style file with coordinates for d3cd6y1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6y1: