Lineage for d3cd6x1 (3cd6 X:7-88)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897334Domain d3cd6x1: 3cd6 X:7-88 [156497]
    Other proteins in same PDB: d3cd621, d3cd6b1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6p1, d3cd6r1, d3cd6s1, d3cd6y1, d3cd6z1
    automatically matched to d1w2bw_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6x1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d3cd6x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6x1 i.1.1.2 (X:7-88) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d3cd6x1:

Click to download the PDB-style file with coordinates for d3cd6x1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6x1: