SCOPe 2.05: Domain d3cd6p1: 3cd6 P:1-143

Lineage for d3cd6p1 (3cd6 P:1-143)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)
   automatically mapped to Pfam PF01280

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
   Uniprot P14119

8. Domain d3cd6p1: 3cd6 P:1-143 [156489]
   Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
   automatically matched to d1s72p_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd6p1

PDB Entry: 3cd6, 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cd6p1:

Sequence; same for both SEQRES and ATOM records:

>d3cd6p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d3cd6p1:

• d3cd6p1 first appeared in SCOP 1.75
  
• d3cd6p1 appears in SCOPe 2.04
  
• d3cd6p1 appears in SCOPe 2.06
  
• d3cd6p1 appears in the current release, SCOPe 2.08