Lineage for d3cd6i1 (3cd6 I:66-129)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763172Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 763200Domain d3cd6i1: 3cd6 I:66-129 [156483]
    Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
    automatically matched to d1s72i_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6i1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d3cd6i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6i1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

SCOP Domain Coordinates for d3cd6i1:

Click to download the PDB-style file with coordinates for d3cd6i1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6i1: