SCOP 1.75: Domain d3cd6f1: 3cd6 F:1-119

Lineage for d3cd6f1 (3cd6 F:1-119)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d3cd6f1: 3cd6 F:1-119 [156481]
   Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
   automatically matched to d1s72f_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6f1

PDB Entry: 3cd6, 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d3cd6f1:

Sequence; same for both SEQRES and ATOM records:

>d3cd6f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d3cd6f1:

• d3cd6f1 is new in SCOP 1.75
  
• d3cd6f1 appears in SCOPe 2.01
  
• d3cd6f1 appears in the current release, SCOPe 2.08