Lineage for d1allb_ (1all B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 44707Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 44708Protein Allophycocyanin [46537] (2 species)
  7. 44722Species Spirulina platensis [TaxId:118562] [46538] (1 PDB entry)
  8. 44724Domain d1allb_: 1all B: [15648]

Details for d1allb_

PDB Entry: 1all (more details), 2.3 Å

PDB Description: allophycocyanin
PDB Compounds: (B:)

SCOP Domain Sequences for d1allb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1allb_ a.1.1.3 (B:) Allophycocyanin {Spirulina platensis}
mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls

SCOP Domain Coordinates for d1allb_:

Click to download the PDB-style file with coordinates for d1allb_.
(The format of our PDB-style files is described here.)

Timeline for d1allb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1alla_