Lineage for d1allb_ (1all B:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.3: Phycocyanin-like [46532] (4 proteins) 
Protein Allophycocyanin [46537] (2 species) Species Spirulina platensis [TaxId:118562] [46538] (1 PDB entry) 
Domain d1allb_: 1all B: [15648]
Details for d1allb_
PDB Entry: 1all (more details), 2.3 Å
PDB Description: allophycocyanin
SCOP Domain Sequences for d1allb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1allb_ a.1.1.3 (B:) Allophycocyanin {Spirulina platensis}
mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls
SCOP Domain Coordinates for d1allb_:
Click to download the PDB-style file with coordinates for d1allb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1allb_:
View in 3D
