Lineage for d1allb_ (1all B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688862Protein Allophycocyanin beta subunit [88957] (3 species)
  7. 2688872Species Spirulina platensis [TaxId:118562] [88958] (1 PDB entry)
  8. 2688873Domain d1allb_: 1all B: [15648]
    Other proteins in same PDB: d1alla_
    complexed with cyc

Details for d1allb_

PDB Entry: 1all (more details), 2.3 Å

PDB Description: allophycocyanin
PDB Compounds: (B:) allophycocyanin

SCOPe Domain Sequences for d1allb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1allb_ a.1.1.3 (B:) Allophycocyanin beta subunit {Spirulina platensis [TaxId: 118562]}
mqdaitsvinssdvqgkyldasaiqklkayfatgelrvraattisanaanivkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpigatvqaiqamkevtaglvgggagkemgiyfdyicsgls

SCOPe Domain Coordinates for d1allb_:

Click to download the PDB-style file with coordinates for d1allb_.
(The format of our PDB-style files is described here.)

Timeline for d1allb_: