Lineage for d3cd611 (3cd6 1:1-56)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648533Domain d3cd611: 3cd6 1:1-56 [156476]
    Other proteins in same PDB: d3cd621, d3cd6b1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6p1, d3cd6r1, d3cd6s1, d3cd6y1, d3cd6z1
    automatically matched to d1w2bz_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd611

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3cd611:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd611 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3cd611:

Click to download the PDB-style file with coordinates for d3cd611.
(The format of our PDB-style files is described here.)

Timeline for d3cd611: