SCOPe 2.07: Domain d3ccvz1: 3ccv Z:35-106

Lineage for d3ccvz1 (3ccv Z:35-106)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
   automatically mapped to Pfam PF01780

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d3ccvz1: 3ccv Z:35-106 [156475]
   Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1
   automatically matched to d1s72z_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvz1

PDB Entry: 3ccv, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3ccvz1:

Sequence; same for both SEQRES and ATOM records:

>d3ccvz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

Timeline for d3ccvz1:

• d3ccvz1 first appeared in SCOP 1.75
  
• d3ccvz1 appears in SCOPe 2.06
  
• d3ccvz1 appears in the current release, SCOPe 2.08