Lineage for d3ccvy1 (3ccv Y:95-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459800Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2459860Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2459861Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2459862Protein Ribosomal protein L32e [52044] (1 species)
  7. 2459863Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2459910Domain d3ccvy1: 3ccv Y:95-236 [156474]
    Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvz1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvy1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccvy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3ccvy1:

Click to download the PDB-style file with coordinates for d3ccvy1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvy1: