Lineage for d1alla_ (1all A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 737Family a.1.1.3: Phycocyanins [46532] (5 proteins)
  6. 738Protein Allophycocyanin [46537] (2 species)
  7. 752Species Spirulina platensis [TaxId:118562] [46538] (1 PDB entry)
  8. 753Domain d1alla_: 1all A: [15647]

Details for d1alla_

PDB Entry: 1all (more details), 2.3 Å

PDB Description: allophycocyanin
PDB Compounds: (A:)

SCOP Domain Sequences for d1alla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alla_ a.1.1.3 (A:) Allophycocyanin {Spirulina platensis}
sivtksivnadaearylspgeldriksfvtsgerrvriaetmtgareriikqagdqlfgk
rpdvvspggnaygadmtatclrdldyylrlitygivagdvtpieeigvvgvremykslgt
pieaiaegvramksvatsllsgadaaeagsyfdyligams

SCOP Domain Coordinates for d1alla_:

Click to download the PDB-style file with coordinates for d1alla_.
(The format of our PDB-style files is described here.)

Timeline for d1alla_: