SCOPe 2.08: Domain d1alla_: 1all A:

Lineage for d1alla_ (1all A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Allophycocyanin alpha subunit [88953] (3 species)

7. Species Spirulina platensis [TaxId:118562] [88954] (1 PDB entry)

8. Domain d1alla_: 1all A: [15647]
   Other proteins in same PDB: d1allb_
   complexed with cyc

Details for d1alla_

PDB Entry: 1all, 2.3 Å

PDB Description: allophycocyanin

PDB Compounds: (A:) allophycocyanin

SCOPe Domain Sequences for d1alla_:

Sequence; same for both SEQRES and ATOM records:

>d1alla_ a.1.1.3 (A:) Allophycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]}
sivtksivnadaearylspgeldriksfvtsgerrvriaetmtgareriikqagdqlfgk
rpdvvspggnaygadmtatclrdldyylrlitygivagdvtpieeigvvgvremykslgt
pieaiaegvramksvatsllsgadaaeagsyfdyligams

Timeline for d1alla_:

• d1alla_ first appeared (with stable ids) in SCOP 1.55
  
• d1alla_ appears in SCOPe 2.07