![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccvt1: 3ccv T:1-119 [156469] Other proteins in same PDB: d3ccv21, d3ccvb1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvp1, d3ccvr1, d3ccvs1, d3ccvy1, d3ccvz1 automatically matched to d1w2bs_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccv (more details), 2.9 Å
SCOPe Domain Sequences for d3ccvt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccvt1 i.1.1.2 (T:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d3ccvt1: