SCOP 1.75: Domain d3ccvs1: 3ccv S:1-81

Lineage for d3ccvs1 (3ccv S:1-81)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
   Uniprot P12732

8. Domain d3ccvs1: 3ccv S:1-81 [156468]
   Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
   automatically matched to d1jj2r_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccvs1

PDB Entry: 3ccv, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d3ccvs1:

Sequence; same for both SEQRES and ATOM records:

>d3ccvs1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3ccvs1:

• d3ccvs1 is new in SCOP 1.75
  
• d3ccvs1 appears in SCOPe 2.01
  
• d3ccvs1 appears in the current release, SCOPe 2.08