Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin beta subunit [88940] (8 species) |
Species Fremyella diplosiphon [TaxId:1197] [88943] (1 PDB entry) |
Domain d1cpcl_: 1cpc L: [15646] Other proteins in same PDB: d1cpca_, d1cpck_ complexed with cyc |
PDB Entry: 1cpc (more details), 1.66 Å
SCOPe Domain Sequences for d1cpcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpcl_ a.1.1.3 (L:) Phycocyanin beta subunit {Fremyella diplosiphon [TaxId: 1197]} mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava
Timeline for d1cpcl_: