SCOPe 2.01: Domain d3ccvi1: 3ccv I:66-129

Lineage for d3ccvi1 (3ccv I:66-129)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3ccvi1: 3ccv I:66-129 [156459]
   Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
   automatically matched to d1s72i_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvi1

PDB Entry: 3ccv, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3ccvi1:

Sequence; same for both SEQRES and ATOM records:

>d3ccvi1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3ccvi1:

• d3ccvi1 first appeared in SCOP 1.75
  
• d3ccvi1 appears in SCOPe 2.02
  
• d3ccvi1 appears in the current release, SCOPe 2.08