SCOPe 2.04: Domain d3ccvf1: 3ccv F:1-119

Lineage for d3ccvf1 (3ccv F:1-119)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d3ccvf1: 3ccv F:1-119 [156457]
   Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
   automatically matched to d1s72f_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvf1

PDB Entry: 3ccv, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3ccvf1:

Sequence; same for both SEQRES and ATOM records:

>d3ccvf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d3ccvf1:

• d3ccvf1 first appeared in SCOP 1.75
  
• d3ccvf1 appears in SCOPe 2.03
  
• d3ccvf1 appears in SCOPe 2.05
  
• d3ccvf1 appears in the current release, SCOPe 2.08