Lineage for d3ccv21 (3ccv 2:1-49)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346685Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2346686Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2346687Protein Ribosomal protein L39e [48664] (1 species)
  7. 2346688Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2346735Domain d3ccv21: 3ccv 2:1-49 [156453]
    Other proteins in same PDB: d3ccv11, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccv21

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3ccv21:

Sequence, based on SEQRES records: (download)

>d3ccv21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3ccv21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d3ccv21:

Click to download the PDB-style file with coordinates for d3ccv21.
(The format of our PDB-style files is described here.)

Timeline for d3ccv21: