Class a: All alpha proteins [46456] (285 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) interrupted alpha-helix automatically mapped to Pfam PF00832 |
Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
Protein Ribosomal protein L39e [48664] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
Domain d3ccv21: 3ccv 2:1-49 [156453] Other proteins in same PDB: d3ccv11, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1 automatically matched to 1VQ4 2:1-49 complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccv (more details), 2.9 Å
SCOPe Domain Sequences for d3ccv21:
Sequence, based on SEQRES records: (download)
>d3ccv21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d3ccv21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d3ccv21: