SCOPe 2.07: Domain d3ccuy1: 3ccu Y:95-236

Lineage for d3ccuy1 (3ccu Y:95-236)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d3ccuy1: 3ccu Y:95-236 [156450]
   Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuz1
   automatically matched to d1jj2x_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccuy1

PDB Entry: 3ccu, 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccuy1:

Sequence; same for both SEQRES and ATOM records:

>d3ccuy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d3ccuy1:

• d3ccuy1 first appeared in SCOP 1.75
  
• d3ccuy1 appears in SCOPe 2.06
  
• d3ccuy1 appears in the current release, SCOPe 2.08