Lineage for d1cpck_ (1cpc K:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302333Protein Phycocyanin alpha subunit [88933] (10 species)
  7. 2302334Species Fremyella diplosiphon [TaxId:1197] [88937] (1 PDB entry)
  8. 2302336Domain d1cpck_: 1cpc K: [15645]
    Other proteins in same PDB: d1cpcb_, d1cpcl_
    complexed with cyc

Details for d1cpck_

PDB Entry: 1cpc (more details), 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution
PDB Compounds: (K:) c-phycocyanin (alpha subunit)

SCOPe Domain Sequences for d1cpck_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpck_ a.1.1.3 (K:) Phycocyanin alpha subunit {Fremyella diplosiphon [TaxId: 1197]}
mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
tfdlspswyvealkyikanhglsgdpaveansyidyainals

SCOPe Domain Coordinates for d1cpck_:

Click to download the PDB-style file with coordinates for d1cpck_.
(The format of our PDB-style files is described here.)

Timeline for d1cpck_: