SCOPe 2.05: Domain d1cpck_: 1cpc K:

Lineage for d1cpck_ (1cpc K:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Fremyella diplosiphon [TaxId:1197] [88937] (1 PDB entry)

8. Domain d1cpck_: 1cpc K: [15645]
   Other proteins in same PDB: d1cpcb_, d1cpcl_
   complexed with cyc

Details for d1cpck_

PDB Entry: 1cpc, 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution

PDB Compounds: (K:) c-phycocyanin (alpha subunit)

SCOPe Domain Sequences for d1cpck_:

Sequence; same for both SEQRES and ATOM records:

>d1cpck_ a.1.1.3 (K:) Phycocyanin alpha subunit {Fremyella diplosiphon [TaxId: 1197]}
mktplteavaaadsqgrflssteiqtafgrfrqasaslaaakaltekasslasgaanavy
skfpyttsqngpnfastqtgkdkcvrdigyylrmvtyclvvggtgplddyliggiaeinr
tfdlspswyvealkyikanhglsgdpaveansyidyainals

Timeline for d1cpck_:

• d1cpck_ first appeared (with stable ids) in SCOP 1.55
  
• d1cpck_ appears in SCOPe 2.04
  
• d1cpck_ appears in SCOPe 2.06
  
• d1cpck_ appears in the current release, SCOPe 2.08