Lineage for d3ccuu1 (3ccu U:4-56)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1468862Domain d3ccuu1: 3ccu U:4-56 [156446]
    Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1
    automatically matched to d1w2bt_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccuu1

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3ccuu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccuu1 i.1.1.2 (U:4-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d3ccuu1:

Click to download the PDB-style file with coordinates for d3ccuu1.
(The format of our PDB-style files is described here.)

Timeline for d3ccuu1: