![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries) Uniprot P12732 |
![]() | Domain d3ccus1: 3ccu S:1-81 [156444] Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1 automatically matched to d1jj2r_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccus1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccus1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasri
Timeline for d3ccus1: