SCOPe 2.02: Domain d3ccup1: 3ccu P:1-143

Lineage for d3ccup1 (3ccu P:1-143)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
   Uniprot P14119

8. Domain d3ccup1: 3ccu P:1-143 [156441]
   Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1
   automatically matched to d1s72p_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccup1

PDB Entry: 3ccu, 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3ccup1:

Sequence; same for both SEQRES and ATOM records:

>d3ccup1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d3ccup1:

• d3ccup1 first appeared in SCOP 1.75
  
• d3ccup1 appears in SCOPe 2.01
  
• d3ccup1 appears in SCOPe 2.03
  
• d3ccup1 appears in the current release, SCOPe 2.08