![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccuj1: 3ccu J:4-145 [156436] Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1 automatically matched to d1w2bi_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccuj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccuj1 i.1.1.2 (J:4-145) 50S subunit {Haloarcula marismortui [TaxId: 2238]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlganktw
Timeline for d3ccuj1: