![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries) Uniprot P20279 |
![]() | Domain d3ccub1: 3ccu B:1-337 [156431] Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1 automatically matched to d1jj2b_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOPe Domain Sequences for d3ccub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccub1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]} pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
Timeline for d3ccub1: