Lineage for d3ccsz1 (3ccs Z:35-106)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966434Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 1966435Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1966436Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1966469Domain d3ccsz1: 3ccs Z:35-106 [156427]
    Other proteins in same PDB: d3ccs11, d3ccs21, d3ccs31, d3ccsb1, d3ccsd1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsj1, d3ccsk1, d3ccsl1, d3ccsn1, d3ccso1, d3ccsp1, d3ccsq1, d3ccsr1, d3ccss1, d3ccst1, d3ccsu1, d3ccsv1, d3ccsw1, d3ccsx1, d3ccsy1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsz1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3ccsz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3ccsz1:

Click to download the PDB-style file with coordinates for d3ccsz1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsz1: