Lineage for d1phnb_ (1phn B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718215Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1718219Species Red alga (Cyanidium caldarium) [TaxId:2771] [88941] (1 PDB entry)
  8. 1718220Domain d1phnb_: 1phn B: [15642]
    Other proteins in same PDB: d1phna_
    complexed with cyc, peb

Details for d1phnb_

PDB Entry: 1phn (more details), 1.65 Å

PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
PDB Compounds: (B:) phycocyanin

SCOPe Domain Sequences for d1phnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phnb_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Cyanidium caldarium) [TaxId: 2771]}
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq

SCOPe Domain Coordinates for d1phnb_:

Click to download the PDB-style file with coordinates for d1phnb_.
(The format of our PDB-style files is described here.)

Timeline for d1phnb_: