Lineage for d1phnb_ (1phn B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.3: Phycocyanins [46532] (5 proteins) 
Protein Phycocyanin [46533] (1 species) Species Red alga (Cyanidium caldarium) [TaxId:2771] [46534] (1 PDB entry) 
Domain d1phnb_: 1phn B: [15642]
Details for d1phnb_
PDB Entry: 1phn (more details), 1.65 Å
PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
SCOP Domain Sequences for d1phnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phnb_ a.1.1.3 (B:) Phycocyanin {Red alga (Cyanidium caldarium)}
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq
SCOP Domain Coordinates for d1phnb_:
Click to download the PDB-style file with coordinates for d1phnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1phnb_:
- d1phnb_ appears in SCOP 1.57
- d1phnb_ appears in the current release, SCOPe 2.08
View in 3D
